SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000404768.1.73277 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000404768.1.73277
Domain Number 1 Region: 1-133
Classification Level Classification E-value
Superfamily Phage tail protein-like 1.44e-35
Family STM4215-like 0.00000559
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000404768.1.73277
Sequence length 151
Comment hypothetical protein [Escherichia coli]; AA=GCF_000939135.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=46A_L1; AL=Contig; RT=Major
Sequence
MEILSVMNSVVTRLREQNPEMDVSISSVDTHKYIPQTQQVTVIINYSGSLFAMPESSDAL
VQQQTLRLTATVIVGKNCDALNALDRIRSALGGLQLPDCDRLLWLEKEINTGESGGFCRY
ILEMATSSLFIAEQENTDLPLLTEVNYEETE
Download sequence
Identical sequences A0A1X3M1N2
WP_000404768.1.18383 WP_000404768.1.33222 WP_000404768.1.38782 WP_000404768.1.39575 WP_000404768.1.43501 WP_000404768.1.46841 WP_000404768.1.49321 WP_000404768.1.62424 WP_000404768.1.73277 WP_000404768.1.77134 WP_000404768.1.79389 WP_000404768.1.8679 WP_000404768.1.87635 WP_000404768.1.96519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]