SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000440620.1.11609 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000440620.1.11609
Domain Number - Region: 118-166
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 0.0209
Family Calpain large subunit, middle domain (domain III) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000440620.1.11609
Sequence length 245
Comment zinc uptake transporter [Bacillus cereus]; AA=GCF_000399165.1; RF=na; TAX=1053167; STAX=1396; NAME=Bacillus cereus BAG1O-1; strain=BAG1O-1; AL=Scaffold; RT=Major
Sequence
MERLWIPMIVTFFSFGGLLLGGAVGVATRQLIEEKMHRLYALCGGILLGLLSLEIIPETF
SSYEIIGPILGIAIGILVMSLLDNYCHHPNIHKKDQQAWQTFLFLSFAIFIHNIPSGFAL
GTAFINHNDSAIPFLIAIVVHHIPEGLALIIPFLFTKHTYISFLLTTLLLSLILGTGTVF
GVLMEGKALHLQGLIMGSAIGSLGYVTIHEMLWKAKKQLSFLTFLTWAISGFLLITVFTL
FAGHH
Download sequence
Identical sequences J8R1Q7 R8HYF3
WP_000440620.1.11609 WP_000440620.1.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]