SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000459589.1.50957 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000459589.1.50957
Domain Number - Region: 54-104
Classification Level Classification E-value
Superfamily Oxygen-evolving enhancer protein 3, 0.00129
Family Oxygen-evolving enhancer protein 3, 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000459589.1.50957
Sequence length 171
Comment MULTISPECIES: twin-arginine translocase subunit TatB [Shigella]; AA=GCF_000211975.1; RF=na; TAX=766141; STAX=1776082; NAME=Shigella boydii 5216-82; strain=5216-82; AL=Contig; RT=Major
Sequence
MFDIGFSELLLVFIIGLVVLGPQRLPVAVKTVAGWIRALRSLATTVQNELTQELKLQEFQ
DSLKKVEKASLTNLTPELKASMDELRQAAESMKRSYVANAPEKASDEAHTIHNPVVKDNE
AAHEGVTPAAAQTQASSPEQKPETTPEPVVKPAADAEPKTAAPSPSSSDKP
Download sequence
Identical sequences F3WQB2
WP_000459589.1.47171 WP_000459589.1.50957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]