SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000494441.1.48698 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000494441.1.48698
Domain Number - Region: 7-40
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.0051
Family Nuclear receptor coactivator interlocking domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000494441.1.48698
Sequence length 90
Comment MULTISPECIES: hypothetical protein [Streptococcus]; AA=GCF_001126025.1; RF=na; TAX=1313; STAX=1313; NAME=Streptococcus pneumoniae; strain=SMRU2313; AL=Contig; RT=Major
Sequence
MFTKLFKKKQDNSDVFKKLIHRLSDMPVQNLEKIDRLLDIIFTPDQESEQVKTESIYREE
TLDDTLKEAKNQLHKEQLEKNLERFRKNSQ
Download sequence
Identical sequences A0A0U0JUK3 F5VV25
WP_000494441.1.101080 WP_000494441.1.101127 WP_000494441.1.10914 WP_000494441.1.14740 WP_000494441.1.16053 WP_000494441.1.20008 WP_000494441.1.2263 WP_000494441.1.2900 WP_000494441.1.32792 WP_000494441.1.37640 WP_000494441.1.38238 WP_000494441.1.3876 WP_000494441.1.41008 WP_000494441.1.41937 WP_000494441.1.44987 WP_000494441.1.48698 WP_000494441.1.50070 WP_000494441.1.50305 WP_000494441.1.51835 WP_000494441.1.53068 WP_000494441.1.54810 WP_000494441.1.57677 WP_000494441.1.62443 WP_000494441.1.71926 WP_000494441.1.73043 WP_000494441.1.73500 WP_000494441.1.79451 WP_000494441.1.8003 WP_000494441.1.8293 WP_000494441.1.8963 WP_000494441.1.94711 WP_000494441.1.99382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]