SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000597764.1.51949 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000597764.1.51949
Domain Number - Region: 31-45,84-114
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0628
Family Ypt/Rab-GAP domain of gyp1p 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000597764.1.51949
Sequence length 119
Comment hypothetical protein [Escherichia coli]; AA=GCF_001067425.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=812_SBOY; AL=Scaffold; RT=Major
Sequence
MIKSVNTSPLSKEDALIRIKQAEANLLKANERLDYLTRKTYLIQITINNKIYFLCDDDSL
SEKFGRAIKFKRKCDASQELMFWFDRIDAVDSQNLKCEIVIEKDLLRNFISHTKKQINK
Download sequence
Identical sequences A0A0G3K5T2
WP_000597764.1.22691 WP_000597764.1.44668 WP_000597764.1.44975 WP_000597764.1.48216 WP_000597764.1.51949 WP_000597764.1.79995 WP_000597764.1.94927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]