SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000604103.1.50003 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000604103.1.50003
Domain Number - Region: 20-58
Classification Level Classification E-value
Superfamily GAT-like domain 0.0262
Family GAT domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000604103.1.50003
Sequence length 102
Comment hypothetical protein [Salmonella enterica]; AA=GCF_001051625.1; RF=na; TAX=935706; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Newport str. VA_R100804798; strain=VA_R100804798; AL=Contig; RT=Major
Sequence
MILTLNDKREISQIIASFTDDDYERINSEVDRLCKRCDPISEMLRSYKPDEHTKDAIDWL
EDDDCNYQEKAAEWFWDAITERVKAEYAFAIFKCRHVYGEAE
Download sequence
Identical sequences ABEW01000005|CDS_332429-332121 WP_000604103.1.158 WP_000604103.1.42605 WP_000604103.1.44443 WP_000604103.1.44678 WP_000604103.1.46406 WP_000604103.1.50003 WP_000604103.1.56905 WP_000604103.1.64266 WP_000604103.1.65795 WP_000604103.1.67924 WP_000604103.1.79966 WP_000604103.1.80667 WP_000604103.1.80674 WP_000604103.1.83119 WP_000604103.1.86601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]