SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000669337.1.51531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000669337.1.51531
Domain Number 1 Region: 89-207
Classification Level Classification E-value
Superfamily OmpA-like 9.42e-30
Family OmpA-like 0.0031
Further Details:      
 
Weak hits

Sequence:  WP_000669337.1.51531
Domain Number - Region: 20-74
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.0102
Family Coiled-coil dimerization domain from cortexillin I 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000669337.1.51531
Sequence length 223
Comment endoflagellar motor protein [Leptospira interrogans]; AA=GCF_001568965.1; RF=na; TAX=173; STAX=173; NAME=Leptospira interrogans; strain=56135; AL=Contig; RT=Major
Sequence
MKFKIFIFAILFLINCVSNSKYESLLKSYEESKLENQRILGEKGDLSRSLEELKRIQEES
DRRIQEYKALMSTFRFLIDAGKLKIKIIDGRMVVVLSSDILFPIGSAHLSPTGTAAIKEV
TTLLASLEGKRFQIEGHTDDTPTGIKGYTNWELASSRALNVLHTMIKAGMPEVRISAASM
GASRPALPNTSPENRSSNRRIEIVIVPDLSNLPGMEELQKYSN
Download sequence
Identical sequences A0A0C5WUF3 A0A0E2D3P3 A0A163NY92 A0A1R0JTH3
WP_000669337.1.102083 WP_000669337.1.11416 WP_000669337.1.12132 WP_000669337.1.1506 WP_000669337.1.16487 WP_000669337.1.175 WP_000669337.1.25259 WP_000669337.1.27867 WP_000669337.1.36087 WP_000669337.1.36581 WP_000669337.1.44274 WP_000669337.1.44326 WP_000669337.1.45262 WP_000669337.1.45679 WP_000669337.1.47686 WP_000669337.1.50856 WP_000669337.1.51443 WP_000669337.1.51531 WP_000669337.1.5368 WP_000669337.1.54587 WP_000669337.1.55852 WP_000669337.1.56812 WP_000669337.1.60409 WP_000669337.1.61403 WP_000669337.1.6171 WP_000669337.1.62172 WP_000669337.1.62196 WP_000669337.1.62202 WP_000669337.1.63688 WP_000669337.1.66305 WP_000669337.1.67411 WP_000669337.1.67421 WP_000669337.1.68799 WP_000669337.1.71080 WP_000669337.1.71461 WP_000669337.1.73036 WP_000669337.1.73583 WP_000669337.1.74258 WP_000669337.1.75316 WP_000669337.1.76063 WP_000669337.1.78739 WP_000669337.1.81443 WP_000669337.1.8167 WP_000669337.1.84376 WP_000669337.1.87965 WP_000669337.1.88138 WP_000669337.1.90188 WP_000669337.1.96462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]