SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000678893.1.52756 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000678893.1.52756
Domain Number - Region: 10-59
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00183
Family Intermediate filament protein, coiled coil region 0.007
Further Details:      
 
Domain Number - Region: 51-83
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0602
Family HBL-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000678893.1.52756
Sequence length 87
Comment hypothetical protein [Bacillus cereus]; AA=GCF_001566515.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=MB.8-1; AL=Contig; RT=Major
Sequence
MKGSTKYQLLKADFDHAVKQLKQRNKEIELLRASRDSSIHEYRQLFNERMKLKEEIEFLK
DDVQIRDEHIERLEKELQEYKRAASKG
Download sequence
Identical sequences A0A136F307 A0A1B1P7W0 A0A1B1P802 A0A1B1P871 A0A1B1P8I8 B5LPP5 C2SD36 D2XQ26
WP_000678893.1.12751 WP_000678893.1.13299 WP_000678893.1.18840 WP_000678893.1.21643 WP_000678893.1.27334 WP_000678893.1.33061 WP_000678893.1.43762 WP_000678893.1.45089 WP_000678893.1.46746 WP_000678893.1.46864 WP_000678893.1.48164 WP_000678893.1.48311 WP_000678893.1.48599 WP_000678893.1.51087 WP_000678893.1.52756 WP_000678893.1.55057 WP_000678893.1.72514 WP_000678893.1.77576 WP_000678893.1.91404 WP_000678893.1.91615 WP_000678893.1.97617 WP_000678893.1.99266 YP_002154359.1.87171 YP_009219626.1.57884 YP_009285301.1.52950 gi|375287541|ref|YP_005107979.1|NC_016772 gi|197261544|ref|YP_002154359.1| B5LPP5_9CAUD D2XQ26_9VIRU gi|375287541|ref|YP_005107979.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]