SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000679357.1.24792 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000679357.1.24792
Domain Number 1 Region: 10-53
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.0000049
Family YqbF N-terminal domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000679357.1.24792
Sequence length 60
Comment hypothetical protein [Bacillus cereus]; AA=GCF_000291095.1; RF=na; TAX=1053210; STAX=1396; NAME=Bacillus cereus HuB4-10; strain=HuB4-10; AL=Scaffold; RT=Major
Sequence
MKGVLIRKVVTLRYGGTYTAYGQKFKNGQEETVANEKADYLVSTGHFELVKEVDKKEKET
Download sequence
Identical sequences WP_000679357.1.24792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]