SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000691667.1.13221 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000691667.1.13221
Domain Number 1 Region: 28-182
Classification Level Classification E-value
Superfamily TIMP-like 1.16e-30
Family Tissue inhibitor of metalloproteinases, TIMP 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000691667.1.13221
Sequence length 184
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_002021695.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=WH2015; AL=Scaffold; RT=Major
Sequence
MKIILRMLPVVIICSCILIIFPEKSYACDCITVSAEDAFQKNDVVFEGKVIGVGRKEGVG
IEVLFEVKEIWKGATSSQIIIYTNGGDCVFHFVEGGEYLVYSSQRGSEKRLHTNSCSRTK
RLDEAGADKVALSQIAKESVPTKKVDLKGEMVSGFSWWQIAIISIGLLLIIAVVIFIMRK
MRKK
Download sequence
Identical sequences A0A0B5ZXZ0
WP_000691667.1.13221 WP_000691667.1.23873 WP_000691667.1.24676 WP_000691667.1.26000 WP_000691667.1.33828 WP_000691667.1.3699 WP_000691667.1.46476 WP_000691667.1.4649 WP_000691667.1.62300 WP_000691667.1.69323 WP_000691667.1.782 WP_000691667.1.9269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]