SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000728591.1.89325 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000728591.1.89325
Domain Number - Region: 193-218
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.049
Family p53 tetramerization domain 0.0094
Further Details:      
 
Domain Number - Region: 146-212
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 0.068
Family Band 7/SPFH domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000728591.1.89325
Sequence length 273
Comment hypothetical protein [Bacillus thuringiensis]; AA=GCF_000161715.1; RF=na; TAX=527019; STAX=1428; NAME=Bacillus thuringiensis IBL 200; strain=IBL 200; AL=Chromosome; RT=Major
Sequence
MKKKMMTVFTIGVMSLSILGGASPSETQRGKTDYTQRSKEQLNNGKIQAVHTEEKAEKLG
IETEGKEQITLEKEIHETEVGREAEQLGISIEGKDVGTLSEEIYETKVKQEALKLGISIE
NTSIVDLITQINAIKIKDEADKLGISTDGKEIEDIAEEIYGTKVREEAGKLDISQKGKEI
EELAQEVYEQKVQEEAKKYHIDLYGKDIYQVLREINEQKVLQMADELNMDKMNMNIQELA
EKIKKEQPEKGKELNFVPMIRTDADAFYSYLTN
Download sequence
Identical sequences A0A243E5U1
WP_000728591.1.61919 WP_000728591.1.89325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]