SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000752368.1.499 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000752368.1.499
Domain Number - Region: 11-53
Classification Level Classification E-value
Superfamily PWI domain 0.0235
Family PWI domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000752368.1.499
Sequence length 74
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_000291395.1; RF=na; TAX=1053188; STAX=1396; NAME=Bacillus cereus BAG5O-1; strain=BAG5O-1; AL=Scaffold; RT=Major
Sequence
MACNIDHSIEDVMNKLESQKDFLSEILFKDLNGFLQNKHSQEILNDIFHLLKKYDLVSEE
EREKRNAQLLHIMN
Download sequence
Identical sequences A0A1D3PLK3 A0A2C5JQB6 C2VEV9 R8LR66
WP_000752368.1.100771 WP_000752368.1.14084 WP_000752368.1.2407 WP_000752368.1.24792 WP_000752368.1.24969 WP_000752368.1.24992 WP_000752368.1.30144 WP_000752368.1.37661 WP_000752368.1.42182 WP_000752368.1.42941 WP_000752368.1.4453 WP_000752368.1.46586 WP_000752368.1.474 WP_000752368.1.499 WP_000752368.1.54419 WP_000752368.1.55893 WP_000752368.1.64770 WP_000752368.1.66535 WP_000752368.1.70209 WP_000752368.1.75358 WP_000752368.1.75374 WP_000752368.1.84323 WP_000752368.1.86041 WP_000752368.1.89698 WP_000752368.1.93904 WP_000752368.1.94270 gi|557620339|ref|YP_008781470.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]