SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000765905.1.43442 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000765905.1.43442
Domain Number - Region: 40-140
Classification Level Classification E-value
Superfamily FAS1 domain 0.0667
Family FAS1 domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000765905.1.43442
Sequence length 156
Comment DUF5065 domain-containing protein [Bacillus sp. 7_6_55CFAA_CT2]; AA=GCF_000238655.1; RF=na; TAX=665957; STAX=665957; NAME=Bacillus sp. 7_6_55CFAA_CT2; strain=7_6_55CFAA_CT2; AL=Scaffold; RT=Major
Sequence
MKLGKLALVGVLTFGGFTAVEMIKPTSQAAAAYEEPYSDPYNDSWGFVSPNNFEYLSQFP
NAHMIKKSYRTGDILNYSLSSIKDGPGAVMKIFKVEAGKKPVRYRTIYPQFDANHQNPTW
STVITDVYTPGSYIAVINHVNDSIGYGVSDWFTINK
Download sequence
Identical sequences G9QFH4
WP_000765905.1.43442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]