SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000779990.1.20687 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000779990.1.20687
Domain Number - Region: 133-175
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.00262
Family Surp module (SWAP domain) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000779990.1.20687
Sequence length 240
Comment membrane protein [Bacillus cereus]; AA=GCF_002199845.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=MOD1_Bc186; AL=Scaffold; RT=Major
Sequence
MKLVIPKQHGAWAMLVIPFLLSVILGKPTMYHIPLFIAWFFIYLATYPFLMYIKQKRKKE
YLHAAIVYFLIAFVFGMISLLYEWRILLFVIVMIPFFIVNMYYARQKNERALLNDVSAII
VFCIGGLVSYYFSMKLIDKTALFIALISFLYFLGSTFYVKTMIREKNNPKYRYISWGYHI
MLTVIVFAINPLCSLIFIPSVIRAIILYGKKISIIKVGILEIVNSVYFLIITAIIMKYAI
Download sequence
Identical sequences B9ISG9
361100.BCQ_3112 WP_000779990.1.10762 WP_000779990.1.13024 WP_000779990.1.20687 WP_000779990.1.24184 WP_000779990.1.29209 WP_000779990.1.33045 WP_000779990.1.3318 WP_000779990.1.3615 WP_000779990.1.37093 WP_000779990.1.37990 WP_000779990.1.44463 WP_000779990.1.49428 WP_000779990.1.50316 WP_000779990.1.50514 WP_000779990.1.54775 WP_000779990.1.54782 WP_000779990.1.56055 WP_000779990.1.57203 WP_000779990.1.57815 WP_000779990.1.57859 WP_000779990.1.58814 WP_000779990.1.60274 WP_000779990.1.64377 WP_000779990.1.70645 WP_000779990.1.77690 WP_000779990.1.81088 WP_000779990.1.82533 WP_000779990.1.84337 WP_000779990.1.93932 WP_000779990.1.95457 WP_000779990.1.95484 gi|222096772|ref|YP_002530829.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]