SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000842909.1.6 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000842909.1.6
Domain Number - Region: 22-62
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0381
Family BRCA2 tower domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000842909.1.6
Sequence length 111
Comment MULTISPECIES: hypothetical protein [Bacillus]; AA=GCF_000291055.1; RF=na; TAX=1053172; STAX=1396; NAME=Bacillus cereus BAG1X1-3; strain=BAG1X1-3; AL=Scaffold; RT=Major
Sequence
MKSTDQFQTYEVPWEEFIEALRREMKKQVGADIIDTVVCNLEDGFEVYTYVQGDLDFEYT
EALERKYGSDGKIPNLLTVMLVASIYNTPEENIRLHADQKENPIVEVYVKK
Download sequence
Identical sequences A0A1X6QB54 A0A2B8M187 C2ZAU8 J8RBG7 R8HJZ2 R8P2D4
WP_000842909.1.100621 WP_000842909.1.11609 WP_000842909.1.16355 WP_000842909.1.6 WP_000842909.1.61126 WP_000842909.1.68550 WP_000842909.1.73952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]