SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000849226.1.95457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000849226.1.95457
Domain Number 1 Region: 28-179
Classification Level Classification E-value
Superfamily TIMP-like 6.28e-31
Family Tissue inhibitor of metalloproteinases, TIMP 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000849226.1.95457
Sequence length 181
Comment hypothetical protein [Bacillus cereus]; AA=GCF_002199505.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=MOD1_Bc195; AL=Scaffold; RT=Major
Sequence
MKTILRMLPFVIICSFIFIIFPEKSYACDCINVSAEEAFQKNDVVFEGQVIEVGRKEGGG
IEVLFEVKKIWKGTNSSQIIVYTNGGDCVFHFVEGGEYLIYSSQRGSEKQLHTNSCSGTK
RLDEAGADKVALRQIAKESVPTKKVDLKGEMVSGFSWWQVAIISICLLLIIVFVVRRTRK
K
Download sequence
Identical sequences B9IX54
WP_000849226.1.10762 WP_000849226.1.13024 WP_000849226.1.20687 WP_000849226.1.24184 WP_000849226.1.29209 WP_000849226.1.33045 WP_000849226.1.3318 WP_000849226.1.3615 WP_000849226.1.37093 WP_000849226.1.37990 WP_000849226.1.44463 WP_000849226.1.49428 WP_000849226.1.50316 WP_000849226.1.50514 WP_000849226.1.54775 WP_000849226.1.54782 WP_000849226.1.56055 WP_000849226.1.57203 WP_000849226.1.57815 WP_000849226.1.57859 WP_000849226.1.58814 WP_000849226.1.60274 WP_000849226.1.64377 WP_000849226.1.70645 WP_000849226.1.77690 WP_000849226.1.81088 WP_000849226.1.82533 WP_000849226.1.84337 WP_000849226.1.93932 WP_000849226.1.95457 WP_000849226.1.95484 gi|222095496|ref|YP_002529556.1| 361100.BCQ_1836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]