SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000864669.1.95457 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000864669.1.95457
Domain Number 1 Region: 3-46
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.00000216
Family YqbF N-terminal domain-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000864669.1.95457
Sequence length 54
Comment hypothetical protein [Bacillus cereus]; AA=GCF_002199505.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=MOD1_Bc195; AL=Scaffold; RT=Major
Sequence
MKVINLLLGGTYTAYGQTFKNGQEETVANDKADYLVSTGHFELVREIDKKEKDK
Download sequence
Identical sequences B9J6K1
WP_000864669.1.10762 WP_000864669.1.11044 WP_000864669.1.13024 WP_000864669.1.20687 WP_000864669.1.24184 WP_000864669.1.29209 WP_000864669.1.33045 WP_000864669.1.3615 WP_000864669.1.37093 WP_000864669.1.37990 WP_000864669.1.44463 WP_000864669.1.47097 WP_000864669.1.47441 WP_000864669.1.49428 WP_000864669.1.50316 WP_000864669.1.50514 WP_000864669.1.54775 WP_000864669.1.54782 WP_000864669.1.56055 WP_000864669.1.57815 WP_000864669.1.57859 WP_000864669.1.58814 WP_000864669.1.64377 WP_000864669.1.70645 WP_000864669.1.77690 WP_000864669.1.82533 WP_000864669.1.92347 WP_000864669.1.93932 WP_000864669.1.95457 WP_000864669.1.95484 gi|221316956|ref|YP_002533100.1| 361100.BCQ_PT34 gi|221316956|ref|YP_002533100.1|NC_011971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]