SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000924320.1.24969 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000924320.1.24969
Domain Number - Region: 66-117
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00408
Family Z-DNA binding domain 0.098
Further Details:      
 
Domain Number - Region: 198-268
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.0458
Family MukF C-terminal domain-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000924320.1.24969
Sequence length 322
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_001583755.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=FSL H8-0488; AL=Contig; RT=Major
Sequence
MLLHNFLLSRAKTELSPRIKHLSKTSGAINQAIKKITTYIDTIVLEYEGVTTKDYLTKRK
YEALETVLSYLVQEGYSQVRQDHISKKSGISKPVINYVLTWLQDLGVCQQIKVRRHGKIA
PSIYILTIHNNYLKIIEYFKIKWALAIDVCSTFTKLLSEKLFKKNFVANPENIENDIQVS
SNSLDVFNINKQEKSDKNCELKEKNNRLQDLDDYLSEDQRKAYYYILSQELNHLSEKDAY
TLALRMPHYIDRYARWDFEECVQWFQYNEAQNSNPAHFIKMFGQKSKQNWERRNQNALEK
KSLHGLNKKREFVFYNFLEESN
Download sequence
Identical sequences A0A1E8A2E5 A0A2B5B9I9 C2X5G1
WP_000924320.1.13424 WP_000924320.1.24969 WP_000924320.1.30144 WP_000924320.1.3196 WP_000924320.1.46586 WP_000924320.1.64770 WP_000924320.1.89698 WP_000924320.1.93904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]