SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001002043.1.44445 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001002043.1.44445
Domain Number 1 Region: 22-80
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.000000000000053
Family YqbF N-terminal domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001002043.1.44445
Sequence length 125
Comment hypothetical protein [Escherichia coli]; AA=GCF_001609215.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=STEC 3055; AL=Contig; RT=Major
Sequence
MNEHHTVAATDDSGLQVSGDNSVTVLAEVRCSRSAFRRAGFLFTRGRQQVEVTPEQLARL
EAEPCLTVRILQTPADDAGSVAGVVHAVAGTDLAEAEAEAEAEAGQDAPRKKTGNKAKQA
KKARA
Download sequence
Identical sequences V6G1J7
WP_001002043.1.3873 WP_001002043.1.44445 WP_001002043.1.7052 WP_001002043.1.96177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]