SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001002047.1.74431 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001002047.1.74431
Domain Number 1 Region: 22-80
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.0000000000000497
Family YqbF N-terminal domain-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001002047.1.74431
Sequence length 132
Comment hypothetical protein [Escherichia coli]; AA=GCF_000264015.1; RF=na; TAX=1165949; STAX=562; NAME=Escherichia coli O26:H11 str. CVM9942; strain=CVM9942; AL=Contig; RT=Major
Sequence
MNEHHTVAATDDSGLQVSGDNSVTVLAEVRCSRSAFRRAGFLFTRGRQQVEVTPEQLARL
EAEPCLTVRILQTSADDAGSVAGVVHAVAGTDLAEAEAEAEAEAEAEAEAEAEAGQDAPW
KKTGNKAKQARA
Download sequence
Identical sequences WP_001002047.1.3762 WP_001002047.1.67214 WP_001002047.1.74431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]