SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001026704.1.82378 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001026704.1.82378
Domain Number 1 Region: 222-311
Classification Level Classification E-value
Superfamily C-terminal domain of B transposition protein 1.06e-36
Family C-terminal domain of B transposition protein 0.00000379
Further Details:      
 
Domain Number 2 Region: 60-293
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000521
Family Tandem AAA-ATPase domain 0.096
Further Details:      
 
Weak hits

Sequence:  WP_001026704.1.82378
Domain Number - Region: 19-60
Classification Level Classification E-value
Superfamily DEATH domain 0.00267
Family DEATH domain, DD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_001026704.1.82378
Sequence length 312
Comment transposase [Escherichia coli]; AA=GCF_000948475.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=OLC-682; AL=Contig; RT=Major
Sequence
MNISDIRAELRTLVENEETTFKQIALESGLSTGTISSFINDKYNGDNERVSQILQRWLEK
YHAVAELPEPPRFVETQTVKQIWTSMRFASLTESIAVVCGNPGVGKTEAAREYRRTNNNV
WMITITPSCASVLECLTELAFELGMNDAPRRKGPLSRALRRRLEGTQGLVIIDEADHLGA
EVLEELRLLQESTRIGLVLMGNHRVYSNMTGGNRTVEFARLFSRIAKRTAINKTKKADVK
AIADAWQINGEKELELLQQIAQKPGALRILNHSLRLAAMTAHGKGERVNEDYLRQAFREL
DLDVDISTLLRN
Download sequence
Identical sequences WP_001026704.1.100571 WP_001026704.1.48615 WP_001026704.1.49481 WP_001026704.1.54708 WP_001026704.1.55144 WP_001026704.1.64150 WP_001026704.1.70582 WP_001026704.1.82378 WP_001026704.1.86263 WP_001026704.1.87639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]