SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001106675.1.93413 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001106675.1.93413
Domain Number - Region: 40-143
Classification Level Classification E-value
Superfamily Adenylylcyclase toxin (the edema factor) 0.00275
Family Adenylylcyclase toxin (the edema factor) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001106675.1.93413
Sequence length 243
Comment hypothetical protein [Leptospira interrogans]; AA=GCF_001995195.1; RF=na; TAX=176; STAX=173; NAME=Leptospira interrogans serovar Hardjo; strain=OV5; AL=Contig; RT=Major
Sequence
MNYILEKLNKQVIWINTDPNRLVGEKAWGDFKPNQHEIVYSLHYNPEIGETFVAEIKEGV
AQDFIPQKVYNKISGEERILQSWEDKIDSEIETEIEPFKDSAENLVEYQKYTDFGWMIDQ
ERKKESLLEKNSQTFYSKLDSYRSKVVYRNTLWDSGKTYLENIQKTLTLYNKQRIISIPE
WRDANDQFHSLSVEELSELLDLIELDLFNAGRILYTKKWEMEEKIRHLAPQEFLDLSIEW
NLS
Download sequence
Identical sequences A0A0M4MSE0 M6GVQ6
WP_001106675.1.100607 WP_001106675.1.18925 WP_001106675.1.31321 WP_001106675.1.48838 WP_001106675.1.5165 WP_001106675.1.51773 WP_001106675.1.67243 WP_001106675.1.93413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]