SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001106691.1.71461 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001106691.1.71461
Domain Number - Region: 40-164
Classification Level Classification E-value
Superfamily Adenylylcyclase toxin (the edema factor) 0.00654
Family Adenylylcyclase toxin (the edema factor) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_001106691.1.71461
Sequence length 243
Comment hypothetical protein [Leptospira interrogans]; AA=GCF_001567895.1; RF=na; TAX=173; STAX=173; NAME=Leptospira interrogans; strain=56626; AL=Contig; RT=Major
Sequence
MNYILEKLNKQVIWINTDPNRLVGEKAWGNFKPNQHEIVYSLHYNPEVGEKFVAEIKDGV
AQDFTLQKVYNKISGEERILQSWEDKIDSEIETEIEPFKDSAGNLVEYQKYTDSGWMIDQ
ERKKESLLERNSQTFYSKLDSYRSKVGYRNTLWDSGKTYLENIQKTLTLYNKQRIISIPE
WRDANDQFHSLSVEELSELLDLIELDLFNAGRILYTKKWEMEEKIRHLAPQEFLDLSIEW
NLS
Download sequence
Identical sequences A0A098MSK1 A0A161RPZ2 A0A1R0JMX9
WP_001106691.1.12132 WP_001106691.1.1506 WP_001106691.1.16487 WP_001106691.1.25259 WP_001106691.1.36087 WP_001106691.1.44274 WP_001106691.1.45262 WP_001106691.1.45679 WP_001106691.1.47686 WP_001106691.1.50856 WP_001106691.1.54587 WP_001106691.1.55852 WP_001106691.1.56629 WP_001106691.1.56812 WP_001106691.1.60409 WP_001106691.1.61403 WP_001106691.1.6171 WP_001106691.1.61777 WP_001106691.1.62172 WP_001106691.1.62202 WP_001106691.1.63688 WP_001106691.1.67411 WP_001106691.1.68799 WP_001106691.1.71461 WP_001106691.1.73583 WP_001106691.1.76063 WP_001106691.1.84376 WP_001106691.1.87965 WP_001106691.1.88138 WP_001106691.1.90188 WP_001106691.1.96462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]