SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001139549.1.42237 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001139549.1.42237
Domain Number - Region: 17-81
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00772
Family IP3 receptor type 1 binding core, domain 2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001139549.1.42237
Sequence length 122
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_001044575.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=14294-3 (M6); AL=Scaffold; RT=Major
Sequence
MPSLGLDLSNSRLIMANVDEREYHFIIREHPILGKIISLLENGKEYGLMDKQIANKDKFI
KSELIKLDYFNLDVLQHTPGWIWIGMDQFGLHAREATYNEVDVIMKLKEDLYYIDVYEKV
KM
Download sequence
Identical sequences A0A1C4EKU2 A0A2C3ZLI5
WP_001139549.1.23427 WP_001139549.1.30788 WP_001139549.1.3130 WP_001139549.1.37027 WP_001139549.1.42237 WP_001139549.1.47095 WP_001139549.1.71142 WP_001139549.1.72554 WP_001139549.1.76342 WP_001139549.1.81198 WP_001139549.1.87960 WP_001139549.1.90187 WP_001139549.1.92586 WP_001139549.1.93290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]