SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001222101.1.90979 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001222101.1.90979
Domain Number - Region: 12-35
Classification Level Classification E-value
Superfamily Hsp90 co-chaperone CDC37 0.0196
Family Hsp90 co-chaperone CDC37 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_001222101.1.90979
Sequence length 46
Comment MULTISPECIES: hypothetical protein [Enterobacteriaceae]; AA=GCF_002229125.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=MOD1-EC5536; AL=Contig; RT=Major
Sequence
MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
Download sequence
Identical sequences A0A090JF17 A0A0I1BQS8 A0A1S9JHK5
WP_001222101.1.101935 WP_001222101.1.11690 WP_001222101.1.1315 WP_001222101.1.26474 WP_001222101.1.2826 WP_001222101.1.39249 WP_001222101.1.41734 WP_001222101.1.50345 WP_001222101.1.51505 WP_001222101.1.52543 WP_001222101.1.5639 WP_001222101.1.56882 WP_001222101.1.65546 WP_001222101.1.69818 WP_001222101.1.70576 WP_001222101.1.70723 WP_001222101.1.72322 WP_001222101.1.82296 WP_001222101.1.87109 WP_001222101.1.88263 WP_001222101.1.90979 WP_001222101.1.94695 WP_001222101.1.99874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]