SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001257354.1.17414 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001257354.1.17414
Domain Number 1 Region: 281-446
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-31
Family Histidine kinase 0.0041
Further Details:      
 
Domain Number 2 Region: 208-290
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.22e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0032
Further Details:      
 
Weak hits

Sequence:  WP_001257354.1.17414
Domain Number - Region: 43-81,123-197
Classification Level Classification E-value
Superfamily STAT 0.00294
Family STAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001257354.1.17414
Sequence length 452
Comment two-component sensor histidine kinase [Acinetobacter baumannii]; AA=GCF_000811885.3; RF=na; TAX=470; STAX=470; NAME=Acinetobacter baumannii; strain=UH367_558; AL=Contig; RT=Major
Sequence
MRSNRSSLQSQLVKTTMWSSIVVGLLALSLLTIFSIYHNMSVQDEIMDEISDTLLVSDLS
KHSMKQFDELSDEFDIQYELLDTGQVLTHSHTYQHELFEKGNLSEGFSYFWFDGQLWRSL
AAQQEDSELQVEVFQPISTRIEEVLKALAGYSGLMVLFWLLQWVIVSWRTEQQLAALNLL
SKRIAQKTASNLEPIQEPDVITEIQPVIDALNQLLARLQRALVAEQRFTADASHELRSPL
SAIQMRLQVLQRKYQHIPELDHDFERIQEDVSRSTKILENLLLLARLEPNETEQLELSKS
VVDLNHVLARVIDTVNIDAQAKHMVIETNILSNETKTFANEELMFIAFRNLFDNAIRYSP
ALGAIHVELSQYQQKLKVSIEDTGNGVDDEVLRRLGQRFFRVLGTKQQGSGLGLSITKKI
IQLHGGELHFMHASQGGLKVEVILPFNREIQK
Download sequence
Identical sequences WP_001257354.1.1194 WP_001257354.1.12109 WP_001257354.1.17097 WP_001257354.1.17414 WP_001257354.1.20987 WP_001257354.1.21554 WP_001257354.1.27656 WP_001257354.1.28778 WP_001257354.1.29034 WP_001257354.1.30498 WP_001257354.1.31312 WP_001257354.1.32430 WP_001257354.1.33773 WP_001257354.1.3592 WP_001257354.1.3755 WP_001257354.1.3856 WP_001257354.1.38689 WP_001257354.1.42721 WP_001257354.1.44385 WP_001257354.1.47141 WP_001257354.1.47553 WP_001257354.1.48026 WP_001257354.1.48056 WP_001257354.1.50150 WP_001257354.1.50220 WP_001257354.1.51254 WP_001257354.1.51876 WP_001257354.1.52766 WP_001257354.1.53199 WP_001257354.1.53965 WP_001257354.1.54108 WP_001257354.1.55491 WP_001257354.1.57987 WP_001257354.1.59450 WP_001257354.1.5988 WP_001257354.1.64231 WP_001257354.1.64610 WP_001257354.1.68258 WP_001257354.1.68726 WP_001257354.1.71616 WP_001257354.1.72081 WP_001257354.1.72476 WP_001257354.1.74393 WP_001257354.1.76590 WP_001257354.1.77277 WP_001257354.1.77531 WP_001257354.1.79020 WP_001257354.1.80655 WP_001257354.1.80989 WP_001257354.1.81597 WP_001257354.1.8264 WP_001257354.1.83222 WP_001257354.1.91612 WP_001257354.1.98595 WP_001257354.1.99697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]