SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001257356.1.85359 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001257356.1.85359
Domain Number 1 Region: 281-446
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.22e-31
Family Histidine kinase 0.0042
Further Details:      
 
Domain Number 2 Region: 208-290
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.22e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0032
Further Details:      
 
Weak hits

Sequence:  WP_001257356.1.85359
Domain Number - Region: 43-81,123-197
Classification Level Classification E-value
Superfamily STAT 0.00175
Family STAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_001257356.1.85359
Sequence length 452
Comment two-component sensor histidine kinase [Acinetobacter baumannii]; AA=GCF_000809505.3; RF=na; TAX=470; STAX=470; NAME=Acinetobacter baumannii; strain=UH17_52; AL=Contig; RT=Major
Sequence
MRSNRSSLQSQLVKTTMWSSIVVGLLALSLLTIFSIYHNMSVQDEIMDEISDTLLVSDLS
KHSMKQFDELSDEFDIQYELLDTGQVLTHSHTYQHELFEKGNLSEGFSYFWFDGQLWRSL
AAQQEDSQLQVEVFQPINTRIEEVLKALAGYSGLMVLFWLLQWVIVSWRTEQQLAALNLL
SKRIAQKTASNLEPIQEPDVITEIQPVIDALNQLLARLQRALVAEQRFTADASHELRSPL
SAIQMRLQVLQRKYQHIPELDHDFERIQEDVSRSTKILENLLLLARLEPNETEQLELSKS
VIDLNHVLARVIDTVNIDAQAKHMVIETNILSNETKTFANEELMFIAFRNLFDNAIRYSP
ALGAIHVELSQYQQKLKISIEDTGNGVDDEVLRRLGQRFFRVLGTKQQGSGLGLSITKKI
IQLHGGELHFMHASQGGLKVEVILPFNREIQK
Download sequence
Identical sequences A0A062F5A2
WP_001257356.1.11305 WP_001257356.1.13109 WP_001257356.1.15713 WP_001257356.1.24916 WP_001257356.1.25638 WP_001257356.1.4855 WP_001257356.1.49673 WP_001257356.1.50807 WP_001257356.1.52030 WP_001257356.1.53076 WP_001257356.1.53539 WP_001257356.1.58319 WP_001257356.1.59232 WP_001257356.1.60546 WP_001257356.1.60933 WP_001257356.1.6458 WP_001257356.1.65872 WP_001257356.1.73031 WP_001257356.1.74908 WP_001257356.1.78968 WP_001257356.1.83024 WP_001257356.1.83504 WP_001257356.1.84189 WP_001257356.1.84318 WP_001257356.1.85359 WP_001257356.1.86869 WP_001257356.1.87805 WP_001257356.1.9008 WP_001257356.1.94816 WP_001257356.1.96741 WP_001257356.1.97180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]