SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001257359.1.77660 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001257359.1.77660
Domain Number 1 Region: 281-446
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.25e-32
Family Histidine kinase 0.0041
Further Details:      
 
Domain Number 2 Region: 208-290
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.22e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0032
Further Details:      
 
Weak hits

Sequence:  WP_001257359.1.77660
Domain Number - Region: 43-81,123-197
Classification Level Classification E-value
Superfamily STAT 0.00294
Family STAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001257359.1.77660
Sequence length 452
Comment two-component sensor histidine kinase [Acinetobacter baumannii]; AA=GCF_000292545.1; RF=na; TAX=1210907; STAX=470; NAME=Acinetobacter baumannii BZICU-2; strain=BZICU-2; AL=Contig; RT=Major
Sequence
MRSNRSSLQSQLVKTTMWSSIVVGLLALSLLTIFSIYHNMSVQDEIMDEISDTLLVSDLS
KHSMKQFDELSDEFDIQYELLDTGQVLTHSHTYQHELFEKGNLSEGFSYFWFDGQLWRSL
AAQQEDSQLQVEVFQPISTRIEEVLKALAGYSGLMVLFWLLQWVIVSWRTEQQLAALNLL
SKRIAQKTASNLEPIQEPDVITEIQPVIDALNQLLARLQRALVAEQRFTADASHELRSPL
SAIQMRLQVLQRKYQHIPELDHDFERIQEDVSRSTKILENLLLLARLEPNETEQLELSKS
VVDLNHVLARVIDTVNIDAQAKHMVIETNILSNETKTFANEELMFIAFRNLFDNAIRYSP
ALGAIHVELSQYQQKLKISIEDTGNGVDDEVLRRLGQRFFRVLGTKQQGSGLGLSITKKI
IQLHGGELHFMHASQGGLKVEVILPFNREIQK
Download sequence
Identical sequences A0A009TCR9 A0A158LWZ7 A0A171F8Q3 A0A1S2FKW5
WP_001257359.1.1065 WP_001257359.1.13124 WP_001257359.1.18286 WP_001257359.1.23821 WP_001257359.1.25131 WP_001257359.1.27840 WP_001257359.1.37803 WP_001257359.1.44126 WP_001257359.1.4484 WP_001257359.1.46038 WP_001257359.1.48485 WP_001257359.1.49993 WP_001257359.1.51592 WP_001257359.1.5300 WP_001257359.1.54712 WP_001257359.1.57392 WP_001257359.1.59281 WP_001257359.1.71898 WP_001257359.1.73238 WP_001257359.1.75416 WP_001257359.1.77233 WP_001257359.1.77660 WP_001257359.1.79116 WP_001257359.1.83452 WP_001257359.1.89410 WP_001257359.1.90945 WP_001257359.1.92623 WP_001257359.1.94668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]