SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001279278.1.85592 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_001279278.1.85592
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.47e-19
Family SinR domain-like 0.015
Further Details:      
 
Weak hits

Sequence:  WP_001279278.1.85592
Domain Number - Region: 71-116
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00746
Family BCR-homology GTPase activation domain (BH-domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_001279278.1.85592
Sequence length 119
Comment MULTISPECIES: transcriptional regulator [Bacillus]; AA=GCF_002216125.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=M13; AL=Complete Genome; RT=Major
Sequence
MSDFLKLVGENIRFLRKKRGLTQEELAEQINLQQAYIGGVERGERNISMLTLQKIAVGLE
VSPDEVLNFSNVNLIDNPQREESLSIITSLLHQKNVNELQFILKFLYNFSEFVESNSNK
Download sequence
Identical sequences A0A0J7F6Z6 A0A1M6EBY4 C2T1M7 Q81CU4
gi|30020775|ref|NP_832406.1| NP_832406.1.86172 WP_001279278.1.14006 WP_001279278.1.14176 WP_001279278.1.19438 WP_001279278.1.25599 WP_001279278.1.26637 WP_001279278.1.32927 WP_001279278.1.3561 WP_001279278.1.41464 WP_001279278.1.54240 WP_001279278.1.58822 WP_001279278.1.6304 WP_001279278.1.6846 WP_001279278.1.84422 WP_001279278.1.85592 WP_001279278.1.96437 APC25940 226900.BC2649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]