SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001367320.1.86956 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001367320.1.86956
Domain Number - Region: 3-42
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0216
Family BCR-homology GTPase activation domain (BH-domain) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_001367320.1.86956
Sequence length 96
Comment hypothetical protein [Escherichia coli]; AA=GCF_001616735.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=sheep30; AL=Contig; RT=Major
Sequence
MHLKYYLHNLPESLIPWILILIFNDTDNTPLLFIFISSIYVLLYPYSKLTISRYIKENTK
LKKEPWYLCKLSALFYLLMAIPVGLPSFIYYSLKRK
Download sequence
Identical sequences I2STW6 I2WFP6 V6FX17
WP_001367320.1.12478 WP_001367320.1.13525 WP_001367320.1.14687 WP_001367320.1.19314 WP_001367320.1.20824 WP_001367320.1.2094 WP_001367320.1.26331 WP_001367320.1.29001 WP_001367320.1.29724 WP_001367320.1.33014 WP_001367320.1.33948 WP_001367320.1.3439 WP_001367320.1.36806 WP_001367320.1.37233 WP_001367320.1.3873 WP_001367320.1.40391 WP_001367320.1.41988 WP_001367320.1.42950 WP_001367320.1.44445 WP_001367320.1.44461 WP_001367320.1.44756 WP_001367320.1.4600 WP_001367320.1.46582 WP_001367320.1.56799 WP_001367320.1.57659 WP_001367320.1.59638 WP_001367320.1.61035 WP_001367320.1.6604 WP_001367320.1.7052 WP_001367320.1.72758 WP_001367320.1.76595 WP_001367320.1.77015 WP_001367320.1.77949 WP_001367320.1.78908 WP_001367320.1.80310 WP_001367320.1.81625 WP_001367320.1.86956 WP_001367320.1.88088 WP_001367320.1.88376 WP_001367320.1.92058 WP_001367320.1.94271 WP_001367320.1.98235 WP_001367320.1.99486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]