SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001407038.1.100262 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001407038.1.100262
Domain Number - Region: 9-58
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0504
Family Retrovirus capsid protein C-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_001407038.1.100262
Sequence length 63
Comment MULTISPECIES: hypothetical protein [Enterobacteriaceae]; AA=GCF_001011785.1; RF=na; TAX=208224; STAX=208224; NAME=Enterobacter kobei; strain=GN02186; AL=Contig; RT=Major
Sequence
MHNSLSSIDPFADWAKKLTVMASNNDLSSREVESYTEKMVEQASKDELTVVIKHLLNHIR
MHK
Download sequence
Identical sequences WP_001407038.1.100262 WP_001407038.1.19994 WP_001407038.1.23520 WP_001407038.1.28167 WP_001407038.1.29715 WP_001407038.1.58092 WP_001407038.1.59730 WP_001407038.1.61926 WP_001407038.1.62959 WP_001407038.1.64286 WP_001407038.1.67522 WP_001407038.1.75228 WP_001407038.1.75557 WP_001407038.1.79075 WP_001407038.1.87310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]