SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001408258.1.59989 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001408258.1.59989
Domain Number - Region: 48-121
Classification Level Classification E-value
Superfamily GAT-like domain 0.0942
Family GAT domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_001408258.1.59989
Sequence length 128
Comment hypothetical protein [Escherichia coli]; AA=GCF_000354515.2; RF=na; TAX=1116061; STAX=562; NAME=Escherichia coli MP021017.5; strain=MP021017.5; AL=Contig; RT=Minor
Sequence
MYGNLKSLGITNPEEIDRYSLRQEANNDILKIYFQKDKGEFFAKSVKFKYPRQRKTVVAD
GVGQGYKEVQEISPNLRYIIDELDQICQRDRSEVDLKRKILDDLRHLESVVTNKISEIEA
DLEKLTRK
Download sequence
Identical sequences WP_001408258.1.101387 WP_001408258.1.17017 WP_001408258.1.28544 WP_001408258.1.59989 WP_001408258.1.70370 WP_001408258.1.74860 WP_001408258.1.76376 WP_001408258.1.8172 WP_001408258.1.86110 WP_001408258.1.89165 WP_001408258.1.95518 WP_001408258.1.96278 WP_001408258.1.9631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]