SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001432000.1.47034 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001432000.1.47034
Domain Number - Region: 19-85
Classification Level Classification E-value
Superfamily TIMP-like 0.0824
Family Tissue inhibitor of metalloproteinases, TIMP 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001432000.1.47034
Sequence length 237
Comment hypothetical protein [Escherichia coli]; AA=GCF_001455025.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=22207; AL=Scaffold; RT=Major
Sequence
MTNTKKAAPIWSRLSEQLTRCALCVCDPKHKHGDDSRYQAGGQCNQSGSVRCHTCNERFS
LYSLRNCSRAKAHGANLSDSCSIFLRRLFRAGDNVLVNSLSVIVLSCIAMRRNTSHHGAD
SDYSDSLALRRWRRLISPSSAETINCPVLSPSSFKFSTASAIACGTRASSFLDFALTAFV
AISDFLVIRWLTVYTQENGKTLLTWLTPVTNIVADTFIKVIDEKTKPRKCRYHSQGF
Download sequence
Identical sequences A0A1D7PIC5
WP_001432000.1.10651 WP_001432000.1.12566 WP_001432000.1.16517 WP_001432000.1.19583 WP_001432000.1.21732 WP_001432000.1.24136 WP_001432000.1.25019 WP_001432000.1.37046 WP_001432000.1.42387 WP_001432000.1.47034 WP_001432000.1.48571 WP_001432000.1.50119 WP_001432000.1.53537 WP_001432000.1.67018 WP_001432000.1.72858 WP_001432000.1.74752 WP_001432000.1.75087 WP_001432000.1.82242 WP_001432000.1.91266 WP_001432000.1.96924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]