SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001460380.1.2300 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001460380.1.2300
Domain Number - Region: 21-64
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0149
Family BCR-homology GTPase activation domain (BH-domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001460380.1.2300
Sequence length 70
Comment MULTISPECIES: hypothetical protein [Enterobacteriaceae]; AA=GCF_000357585.2; RF=na; TAX=1116045; STAX=562; NAME=Escherichia coli P0299438.10; strain=P0299438.10; AL=Contig; RT=Minor
Sequence
MADYNSFVLEGIKIIFADNNKEFIKEICEPLINILCIEEYYSATGIYNYDDADVQTELLK
NALRDYKIAH
Download sequence
Identical sequences A0A2H9A3V4
WP_001460380.1.1168 WP_001460380.1.12693 WP_001460380.1.1322 WP_001460380.1.13575 WP_001460380.1.13824 WP_001460380.1.16715 WP_001460380.1.2091 WP_001460380.1.22649 WP_001460380.1.2300 WP_001460380.1.25942 WP_001460380.1.29502 WP_001460380.1.31156 WP_001460380.1.33010 WP_001460380.1.36833 WP_001460380.1.37122 WP_001460380.1.50565 WP_001460380.1.53769 WP_001460380.1.54329 WP_001460380.1.57399 WP_001460380.1.647 WP_001460380.1.66294 WP_001460380.1.67861 WP_001460380.1.69481 WP_001460380.1.75612 WP_001460380.1.80480 WP_001460380.1.8057 WP_001460380.1.81723 WP_001460380.1.86228 WP_001460380.1.91994 WP_001460380.1.97996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]