SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001461851.1.56586 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001461851.1.56586
Domain Number - Region: 27-99
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.0235
Family Coiled-coil dimerization domain from cortexillin I 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_001461851.1.56586
Sequence length 141
Comment phage lysis regulatory, LysB family protein [Escherichia coli]; AA=GCF_000357265.2; RF=na; TAX=1116043; STAX=562; NAME=Escherichia coli P0299438.8; strain=P0299438.8; AL=Contig; RT=Minor
Sequence
MSKLMIVLVVLLSLAVTGLFLVKHKNASLRASLDRANNVASEQQTTITMLKNQLHVALTR
ADKNELAQVALRQELENAAKREAQREKTITRLLNENEDFRRWYGADLPDVVRRLHQRPAC
TDASDCRQRLPESEPLPDAGQ
Download sequence
Identical sequences WP_001461851.1.22599 WP_001461851.1.42756 WP_001461851.1.42771 WP_001461851.1.52846 WP_001461851.1.56586 WP_001461851.1.61398 WP_001461851.1.72184 WP_001461851.1.81283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]