SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001512811.1.13939 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001512811.1.13939
Domain Number - Region: 26-99
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.0196
Family Coiled-coil dimerization domain from cortexillin I 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_001512811.1.13939
Sequence length 147
Comment phage lysis regulatory, LysB family protein [Escherichia coli]; AA=GCF_000316705.2; RF=na; TAX=1005421; STAX=562; NAME=Escherichia coli 99.0672; strain=99.0672; AL=Scaffold; RT=Minor
Sequence
MSKLMIVLVVLLSLAVAGLFLVKHENASLRASLDRVNNVASEQQTTITMLKNQLHVALTR
ADKNELAQVALRQELENAAKREAQREKTITRLLNENEDFRRWYGADLPDTVRRLHQRPAC
TDASDCPQRLPESESLPDAGQRPGDER
Download sequence
Identical sequences WP_001512811.1.13348 WP_001512811.1.13939 WP_001512811.1.14453 WP_001512811.1.19350 WP_001512811.1.23806 WP_001512811.1.23895 WP_001512811.1.25526 WP_001512811.1.312 WP_001512811.1.31825 WP_001512811.1.41294 WP_001512811.1.43013 WP_001512811.1.44165 WP_001512811.1.45153 WP_001512811.1.45707 WP_001512811.1.46282 WP_001512811.1.47884 WP_001512811.1.59733 WP_001512811.1.62135 WP_001512811.1.62541 WP_001512811.1.63563 WP_001512811.1.6364 WP_001512811.1.63957 WP_001512811.1.6445 WP_001512811.1.68936 WP_001512811.1.71423 WP_001512811.1.73785 WP_001512811.1.74557 WP_001512811.1.75577 WP_001512811.1.76054 WP_001512811.1.76152 WP_001512811.1.81873 WP_001512811.1.82820 WP_001512811.1.85253 WP_001512811.1.89988 WP_001512811.1.91153 WP_001512811.1.95129 WP_001512811.1.9616 WP_001512811.1.98155 WP_001512811.1.98543 WP_001512811.1.99472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]