SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001539178.1.44943 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001539178.1.44943
Domain Number - Region: 37-58
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0177
Family PB1 domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001539178.1.44943
Sequence length 85
Comment hypothetical protein [Salmonella enterica]; AA=GCF_000187565.1; RF=na; TAX=904139; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Choleraesuis str. SCSA50; strain=A50; AL=Chromosome; RT=Major
Sequence
MCGNRSAATNTGDCSAADVSGSQSVAAAFGIEGKARASEGGAIVLCYRDEDGELIHIRAS
KVGENGIMPNTWYQLNEDGEFVACE
Download sequence
Identical sequences Q57SR8
AE017220|CDS_381770-381513 WP_001539178.1.15468 WP_001539178.1.17758 WP_001539178.1.22270 WP_001539178.1.32493 WP_001539178.1.36948 WP_001539178.1.44943 WP_001539178.1.50497 WP_001539178.1.50777 WP_001539178.1.5527 WP_001539178.1.57902 WP_001539178.1.60486 WP_001539178.1.71418 WP_001539178.1.76162 WP_001539178.1.99426 gi|62178907|ref|YP_215324.1| 321314.SC0337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]