SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001541169.1.50497 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001541169.1.50497
Domain Number - Region: 12-36,65-103
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0916
Family Gelsolin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_001541169.1.50497
Sequence length 106
Comment hypothetical protein [Salmonella enterica]; AA=GCF_000742815.1; RF=na; TAX=119912; STAX=28901; NAME=Salmonella enterica subsp. enterica serovar Choleraesuis; strain=C500; AL=Complete Genome; RT=Major
Sequence
MQDWPIEVADNRRLDEFLSAYSECNDDECFVLMVILLECIDNFGEQYHKHPSWPVIYDLL
DKHITRHIYTVWYWSCTDCEDEELEDAFYITSDMRALLKKHAYLLR
Download sequence
Identical sequences C0Q2L8 Q57HZ2
321314.SC3764 476213.SPC_3935 gi|224585646|ref|YP_002639445.1| WP_001541169.1.15468 WP_001541169.1.17758 WP_001541169.1.22270 WP_001541169.1.32493 WP_001541169.1.36948 WP_001541169.1.44943 WP_001541169.1.50497 WP_001541169.1.50777 WP_001541169.1.5527 WP_001541169.1.57902 WP_001541169.1.60486 WP_001541169.1.71418 WP_001541169.1.76162 WP_001541169.1.99426 AE017220|CDS_3992663-3992343 CP000857|CDS_3989417-3989097 gi|62182334|ref|YP_218751.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]