SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001561097.1.75644 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001561097.1.75644
Domain Number - Region: 117-151
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 0.0131
Family P-domain of calnexin/calreticulin 0.0057
Further Details:      
 
Domain Number - Region: 10-72
Classification Level Classification E-value
Superfamily PUA domain-like 0.0457
Family yqfB-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_001561097.1.75644
Sequence length 246
Comment hypothetical protein [Escherichia coli]; AA=GCF_001616975.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=sheep41; AL=Contig; RT=Major
Sequence
MKGEVKERGMIFNDEMVRAILEGRKTQTRRIMKNQPAEVGPEAPVMVRKIGAGFQWYGAD
GVSSVFNCPFGIVGDRIWVRETWAILGNEDGCSVDWNDNLCRGDEKNAARIYRASCEQKP
GDYGLWSIPDDADWKPHTVNEKFDGGWRPSIHMPRWASRILLEITNVRVERLNDISECDA
RDEGVQPAGSLLPDHPGTFLTPKGDFAMAKVAFQRLWESIYGEESWNANPWVWVIEFERI
QGATSE
Download sequence
Identical sequences A0A0A8UN20 A0A160HQM8
WP_001561097.1.19649 WP_001561097.1.27611 WP_001561097.1.30808 WP_001561097.1.34538 WP_001561097.1.37266 WP_001561097.1.377 WP_001561097.1.38412 WP_001561097.1.48144 WP_001561097.1.5310 WP_001561097.1.57669 WP_001561097.1.75644 WP_001561097.1.79126 WP_001561097.1.81438 WP_001561097.1.89551 WP_001561097.1.99458 WP_001561097.1.99869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]