SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001684489.1.38843 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001684489.1.38843
Domain Number - Region: 6-29
Classification Level Classification E-value
Superfamily Hsp90 co-chaperone CDC37 0.0157
Family Hsp90 co-chaperone CDC37 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_001684489.1.38843
Sequence length 40
Comment MULTISPECIES: hypothetical protein, partial [Enterobacteriaceae]; AA=GCF_002190435.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=ECOR16; AL=Contig; RT=Major
Sequence
RGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
Download sequence
Identical sequences A0A2A7M0P7
WP_001684489.1.15148 WP_001684489.1.18617 WP_001684489.1.21899 WP_001684489.1.22602 WP_001684489.1.22757 WP_001684489.1.23711 WP_001684489.1.306 WP_001684489.1.37049 WP_001684489.1.38843 WP_001684489.1.41479 WP_001684489.1.47546 WP_001684489.1.5265 WP_001684489.1.57079 WP_001684489.1.585 WP_001684489.1.67153 WP_001684489.1.77081 WP_001684489.1.78010 WP_001684489.1.83668 WP_001684489.1.93291 WP_001684489.1.93870 WP_001684489.1.94302 WP_001684489.1.95428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]