SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001724113.1.52002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001724113.1.52002
Domain Number - Region: 25-52
Classification Level Classification E-value
Superfamily L27 domain 0.0694
Family L27 domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001724113.1.52002
Sequence length 72
Comment hypothetical protein [Escherichia coli]; AA=GCF_000355575.2; RF=na; TAX=1116016; STAX=562; NAME=Escherichia coli 2785200; strain=2785200; AL=Contig; RT=Minor
Sequence
MPKTPRVYVAFCFYICNLNAALAMLGKFLEFAGILCNLHIKWLIFAQDWWVRNGLSLLNK
GLRGYTSANNFL
Download sequence
Identical sequences A0A2I6HAC9
WP_001724113.1.100753 WP_001724113.1.100868 WP_001724113.1.12458 WP_001724113.1.29239 WP_001724113.1.32394 WP_001724113.1.45440 WP_001724113.1.47740 WP_001724113.1.48048 WP_001724113.1.48371 WP_001724113.1.497 WP_001724113.1.51325 WP_001724113.1.51441 WP_001724113.1.52002 WP_001724113.1.56932 WP_001724113.1.57904 WP_001724113.1.5965 WP_001724113.1.60477 WP_001724113.1.66251 WP_001724113.1.68283 WP_001724113.1.69247 WP_001724113.1.75428 WP_001724113.1.84210 WP_001724113.1.88710 WP_001724113.1.90799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]