SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_001841477.1.73675 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_001841477.1.73675
Domain Number - Region: 1-52
Classification Level Classification E-value
Superfamily Domain of poly(ADP-ribose) polymerase 0.0549
Family Domain of poly(ADP-ribose) polymerase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_001841477.1.73675
Sequence length 65
Comment MULTISPECIES: hypothetical protein [Streptococcus]; AA=GCF_001909835.1; RF=na; TAX=1313; STAX=1313; NAME=Streptococcus pneumoniae; strain=MMC_B01; AL=Contig; RT=Major
Sequence
MNKLKEENLRRALSHIERHKQAINTSNNSEDNDFHKLLLQFSYDVYERIKANKKPYPNLD
SDKVF
Download sequence
Identical sequences A0A139RAT9 A0A2I1UCR4 B2IQD4 B7UTV3 F9LVW8 F9MH02 I0SIN6
gi|182684272|ref|YP_001836019.1| 516950.SPCG_1302 WP_001841477.1.12413 WP_001841477.1.14105 WP_001841477.1.14959 WP_001841477.1.17227 WP_001841477.1.19420 WP_001841477.1.35722 WP_001841477.1.58717 WP_001841477.1.58984 WP_001841477.1.61845 WP_001841477.1.6505 WP_001841477.1.65568 WP_001841477.1.66479 WP_001841477.1.67234 WP_001841477.1.6969 WP_001841477.1.73359 WP_001841477.1.73462 WP_001841477.1.73675 WP_001841477.1.76093 WP_001841477.1.76684 WP_001841477.1.76733 WP_001841477.1.82869 WP_001841477.1.84314 WP_001841477.1.92644 WP_001841477.1.94007 WP_001841477.1.96872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]