SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002111098.1.72824 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002111098.1.72824
Domain Number - Region: 16-62
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.051
Family BRCA2 tower domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002111098.1.72824
Sequence length 111
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_001855755.1; RF=na; TAX=86662; STAX=86662; NAME=Bacillus weihenstephanensis; strain=GOE5; AL=Contig; RT=Major
Sequence
MKSTDQFQTYEVPWEEFIKALRGEIKKQVGADIIDTVVCNLKDGFEVYTYMQGDLDFEYK
EALERKYGSDAKIPNLLTVMLLASIYNTSEENIRLHADQKENPIVEVYVKK
Download sequence
Identical sequences A0A1D3MQB3 J9AT51
WP_002111098.1.100215 WP_002111098.1.23136 WP_002111098.1.27138 WP_002111098.1.42272 WP_002111098.1.50487 WP_002111098.1.53672 WP_002111098.1.53916 WP_002111098.1.72824 WP_002111098.1.75300 WP_002111098.1.89263 WP_002111098.1.89564 WP_002111098.1.89932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]