SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002130425.1.75292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002130425.1.75292
Domain Number - Region: 12-65
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0602
Family Ypt/Rab-GAP domain of gyp1p 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002130425.1.75292
Sequence length 95
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_002200005.1; RF=na; TAX=1405; STAX=1405; NAME=Bacillus mycoides; strain=MOD1_Bc228; AL=Scaffold; RT=Major
Sequence
MRSYRIPKEISTELRINKVLYLIDFFLLIGLLVVTMILRNFVHDSFQLPFVIFMAAIAII
MIWRPSTNPQKRMYEVLIITLLRRKGAYCAIDNDQ
Download sequence
Identical sequences A0A084ITF8 A0A1H4HL79 A0A243AGU2 A0A2B4VR62 A0A2C5BX76 A0A2C9Z8Q8 J8DCN7 J8HBV5 J8PHS1 R8ECG0 R8HEZ8 R8Q9C1
WP_002130425.1.10033 WP_002130425.1.100479 WP_002130425.1.10745 WP_002130425.1.10775 WP_002130425.1.17940 WP_002130425.1.21695 WP_002130425.1.22507 WP_002130425.1.27729 WP_002130425.1.2902 WP_002130425.1.31050 WP_002130425.1.35026 WP_002130425.1.37635 WP_002130425.1.37649 WP_002130425.1.39255 WP_002130425.1.4354 WP_002130425.1.47674 WP_002130425.1.63476 WP_002130425.1.6426 WP_002130425.1.64566 WP_002130425.1.72867 WP_002130425.1.75292 WP_002130425.1.85187 WP_002130425.1.87416 WP_002130425.1.99044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]