SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002161105.1.67742 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002161105.1.67742
Domain Number - Region: 133-177
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.000159
Family Surp module (SWAP domain) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_002161105.1.67742
Sequence length 240
Comment MULTISPECIES: membrane protein [Bacillus cereus group]; AA=GCF_000399245.1; RF=na; TAX=1053218; STAX=1396; NAME=Bacillus cereus MC118; strain=MC118; AL=Scaffold; RT=Major
Sequence
MKLVIPKQHGAWAMLVIPFLLSVLLGKPTFYHIPLFLAWFFIYLATYPFLMYIRQRRKKE
FLHAAIVYFIIAFVFGMISLLYEWRILLFAVLMIPLFIVNMYYARQKNERALLNDVCAII
VFCIGGLISYYFSMKFIDRTALFIALISFLYFLGSTFYVKTMIREKNNPKYRFISWGYHI
ILTVIVFTINPWCSLIFVPSVIRAIMLYGKKISILKVGILEIVNSVYFLIITVIMMKYAI
Download sequence
Identical sequences A0A1E8BL72 J8BTQ2 R8JSE1
WP_002161105.1.27138 WP_002161105.1.38270 WP_002161105.1.42272 WP_002161105.1.50487 WP_002161105.1.53916 WP_002161105.1.67742 WP_002161105.1.75300 WP_002161105.1.84599 WP_002161105.1.89932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]