SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002214620.1.67850 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_002214620.1.67850
Domain Number 1 Region: 3-86
Classification Level Classification E-value
Superfamily Adenylylcyclase toxin (the edema factor) 4.58e-32
Family Adenylylcyclase toxin (the edema factor) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002214620.1.67850
Sequence length 96
Comment hypothetical protein [Yersinia pestis]; AA=GCF_000325185.1; RF=na; TAX=755897; STAX=632; NAME=Yersinia pestis M0000002; strain=M0000002; AL=Contig; RT=Major
Sequence
MSEDVNMGNLHHFGKTIVNSLNKEINAEGYAGGKLVWHNDEAGNPFSPGFDENDKPIFFL
PSGGMFQAKNKSELLGFYSRLRRSGYTPEHSPIFGF
Download sequence
Identical sequences A0A0E1NUV0 A0A151PJT9
WP_002214620.1.32388 WP_002214620.1.39346 WP_002214620.1.44598 WP_002214620.1.58794 WP_002214620.1.59687 WP_002214620.1.67850 WP_002214620.1.68855 WP_002214620.1.75407 WP_002214620.1.91844 WP_002214620.1.97864 WP_002214620.1.99416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]