SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002258149.1.27519 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002258149.1.27519
Domain Number - Region: 6-60
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0676
Family alpha-D-mannose-specific plant lectins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_002258149.1.27519
Sequence length 68
Comment hypothetical protein [Neisseria meningitidis]; AA=GCF_000386945.2; RF=na; TAX=1145167; STAX=487; NAME=Neisseria meningitidis 2001001; strain=2001001; AL=Contig; RT=Major
Sequence
MPYWFLLIHYTWHCIGTDENIHSDAKVEYLQDGSFRGDAILKIDDDGNILAYRVVGSGKW
RFENNACA
Download sequence
Identical sequences WP_002258149.1.27519 WP_002258149.1.29867 WP_002258149.1.40364 WP_002258149.1.40732 WP_002258149.1.98500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]