SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002326982.1.2133 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002326982.1.2133
Domain Number - Region: 17-52
Classification Level Classification E-value
Superfamily Fibritin 0.0549
Family Fibritin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002326982.1.2133
Sequence length 92
Comment hypothetical protein [Enterococcus faecium]; AA=GCF_000321565.1; RF=na; TAX=1138885; STAX=1352; NAME=Enterococcus faecium EnGen0014; strain=E0679; AL=Scaffold; RT=Major
Sequence
METLENIFPKKVVLKCNNKRNIEKLTYSVTEAALAITTNPQNVKDLIEMGYIGFLKLGEI
RIPKTEVARFLENHMNEDLASEIAKYREERKK
Download sequence
Identical sequences A0A2I5N0Q6
WP_002326982.1.101748 WP_002326982.1.16275 WP_002326982.1.16400 WP_002326982.1.18125 WP_002326982.1.18498 WP_002326982.1.20068 WP_002326982.1.2133 WP_002326982.1.23667 WP_002326982.1.25166 WP_002326982.1.25533 WP_002326982.1.28072 WP_002326982.1.29064 WP_002326982.1.35962 WP_002326982.1.37495 WP_002326982.1.39827 WP_002326982.1.40087 WP_002326982.1.41158 WP_002326982.1.4123 WP_002326982.1.44852 WP_002326982.1.4544 WP_002326982.1.47357 WP_002326982.1.47810 WP_002326982.1.47985 WP_002326982.1.52099 WP_002326982.1.55962 WP_002326982.1.56820 WP_002326982.1.63595 WP_002326982.1.66284 WP_002326982.1.67125 WP_002326982.1.71588 WP_002326982.1.8262 WP_002326982.1.84395 WP_002326982.1.88447 WP_002326982.1.90955 WP_002326982.1.91317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]