SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002340436.1.88466 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002340436.1.88466
Domain Number - Region: 103-148
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0255
Family BRCA2 tower domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002340436.1.88466
Sequence length 164
Comment MULTISPECIES: hypothetical protein [Enterococcus]; AA=GCF_900179105.1; RF=na; TAX=1352; STAX=1352; NAME=Enterococcus faecium; strain=VREN3285; AL=Scaffold; RT=Major
Sequence
MFKVYFPFQWLVKGILLVLLGLILFGSYLTIKARHFPEEKPIKIVTIDLKIGETYQADGV
ELTFKNIEVTEKRNEFAQHDRVLQVTYTLKNDTEKPIRPQQWSIENKDGEELYEYAMILD
NPEYIESDKAETINYYYELPNEMQDYQIVLRRANGYLVGLPFTL
Download sequence
Identical sequences A0A2A8RJM0 R2R6W7
gi|383329469|ref|YP_005355353.1| WP_002340436.1.10354 WP_002340436.1.10875 WP_002340436.1.11679 WP_002340436.1.15198 WP_002340436.1.16352 WP_002340436.1.23980 WP_002340436.1.26372 WP_002340436.1.29068 WP_002340436.1.29776 WP_002340436.1.31555 WP_002340436.1.32360 WP_002340436.1.37139 WP_002340436.1.37630 WP_002340436.1.44909 WP_002340436.1.46220 WP_002340436.1.51057 WP_002340436.1.5159 WP_002340436.1.56539 WP_002340436.1.63994 WP_002340436.1.68536 WP_002340436.1.73702 WP_002340436.1.7734 WP_002340436.1.78244 WP_002340436.1.82658 WP_002340436.1.83496 WP_002340436.1.86051 WP_002340436.1.86409 WP_002340436.1.88466 WP_002340436.1.89774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]