SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_002341837.1.92113 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_002341837.1.92113
Domain Number - Region: 86-151
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 0.0167
Family tRNA-intron endonuclease catalytic domain-like 0.0066
Further Details:      
 
Domain Number - Region: 32-72
Classification Level Classification E-value
Superfamily PAP/Archaeal CCA-adding enzyme, C-terminal domain 0.0687
Family Poly(A) polymerase, PAP, C-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_002341837.1.92113
Sequence length 210
Comment hypothetical protein [Enterococcus faecium]; AA=GCF_000322105.1; RF=na; TAX=1138915; STAX=1352; NAME=Enterococcus faecium EnGen0024; strain=E1904; AL=Scaffold; RT=Major
Sequence
MNKQEQKNKLWALKWIDKEIEENERHAHQKTGTEANTAYWKGYIASCKNIRYIVKELDEH
PKHVMPKFFDDWAKRVIAKHDEFYAISLVVRAGWGYGVDFELSENGSSSENKELLYWLVD
KCSDNYPNKKKAIEALLYGYEVEKEPLYEVIIGDLYLIKKFNDRNDFCFDTSCSLCTWEK
SAYQLTEAEIKAIDERYWPFAVPVEEVVEG
Download sequence
Identical sequences U7U3V5
WP_002341837.1.33590 WP_002341837.1.92113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]